DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44837 and DPEP1

DIOPT Version :9

Sequence 1:NP_001287037.1 Gene:CG44837 / 5740513 FlyBaseID:FBgn0266100 Length:964 Species:Drosophila melanogaster
Sequence 2:NP_001121613.1 Gene:DPEP1 / 1800 HGNCID:3002 Length:411 Species:Homo sapiens


Alignment Length:369 Identity:159/369 - (43%)
Similarity:230/369 - (62%) Gaps:16/369 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 RILREVPLVDGHNNYAWNVRKYAHSSLELHLSHDVDHKSLWSRPAWAQTDMERLKQGLVSVQVWS 667
            ||:|:.|::||||:..|.:....::.|:       |.::..:..|...|::.:|:.|.|..|.||
Human    25 RIMRDSPVIDGHNDLPWQLLDMFNNRLQ-------DERANLTTLAGTHTNIPKLRAGFVGGQFWS 82

  Fly   668 AYVPCEAQGLDAVQLALEQIDIVRRLSDMYARETVLATSSQDIVDAHRRGLLASLIGVEGGHTIG 732
            .|.||:.|..|||:..|||:|:|.|:..||....:..|||..|..|.|.|.:||||||||||:|.
Human    83 VYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSID 147

  Fly   733 SSLGVLRSFYSLGARYLSLTHRCDVSWAGS------SASPAEQGLTPFGKAIVREMNRLGMMIDL 791
            |||||||:.|.||.|||:|||.|:..||.:      .:.|..|||:|||:.:|:|:||||::|||
Human   148 SSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDL 212

  Fly   792 SHSSDATARDVLQVTRAPVIFSHSAARQLCNSTRNVPDDILRLVAENGGLIMLSFDSEDVACGRQ 856
            :|.|.||.:..||::|||||||||:|..:|.|.||||||:||||.:...|:|::|.:..::|..:
Human   213 AHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNK 277

  Fly   857 ARLQDVIEHIKYVRAIAGIQHIGLGAGYDGIELPPLGLEDVSKYPELLAALLEDHNWSEEDVAML 921
            |.|..|.:|:.:::.:||.:.:|.|..:||:...|.|||||||||:|:|.||. .||:|.:|...
Human   278 ANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLR-RNWTEAEVKGA 341

  Fly   922 AGRNFLRIMETVETVRDYWKRAAIQPI--EQTEPQPKTQCTYMS 963
            ...|.||:.|.||...:..:....:||  :|.....:|...|.|
Human   342 LADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44837NP_001287037.1 rDP_like 609..929 CDD:238626 146/325 (45%)
DPEP1NP_001121613.1 Peptidase_M19 26..352 CDD:395996 149/333 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 1 1.000 - - otm42184
orthoMCL 1 0.900 - - OOG6_102004
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.