DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44837 and dpep2

DIOPT Version :9

Sequence 1:NP_001287037.1 Gene:CG44837 / 5740513 FlyBaseID:FBgn0266100 Length:964 Species:Drosophila melanogaster
Sequence 2:XP_017948963.1 Gene:dpep2 / 100487272 XenbaseID:XB-GENE-6073530 Length:431 Species:Xenopus tropicalis


Alignment Length:375 Identity:168/375 - (44%)
Similarity:242/375 - (64%) Gaps:26/375 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 FLMAP---SRNSHAQRLRIVRRILREVPLVDGHNNYAWNVRKYAHSSLELHLSHDVDHKSLWSRP 646
            |::.|   |.|.....||.: |::::.||:||||::|..:|:...:.|.     .::.:.|.|  
 Frog    22 FVLIPFISSYNDSELELRTM-RLMKQSPLIDGHNDFALQIRRLYQNKLS-----RINLRILNS-- 78

  Fly   647 AWAQTDMERLKQGLVSVQVWSAYVPCEAQGLDAVQLALEQIDIVRRLSDMYARETVLATSSQDIV 711
              .:|::::||.|.|..|.|||||.|.:|..|||:|||||||:::|:.:.| .|..|.|||:.||
 Frog    79 --TRTNIKKLKDGYVGAQFWSAYVLCSSQDKDAVRLALEQIDVIKRMCNEY-DELELVTSSEGIV 140

  Fly   712 DAHRRGLLASLIGVEGGHTIGSSLGVLRSFYSLGARYLSLTHRCDVSWAGSSASPAE------QG 770
            :..:   ||.||||||||.|.||||.||.||.||.||:.|||.|:..||.:|:....      :.
 Frog   141 NTSK---LACLIGVEGGHAIDSSLGTLRMFYDLGVRYMGLTHTCNTPWAETSSYGVHSSYQDTKS 202

  Fly   771 LTPFGKAIVREMNRLGMMIDLSHSSDATARDVLQVTRAPVIFSHSAARQLCNSTRNVPDDILRLV 835
            ||.|||.:|:||||:||:|||||:|..|:|:||.:::||||||||||..|||..||:|||||:.:
 Frog   203 LTDFGKEVVKEMNRIGMIIDLSHTSFNTSREVLNISKAPVIFSHSAAFALCNINRNIPDDILKGI 267

  Fly   836 AENGGLIMLSFDSEDVACGRQARLQDVIEHIKYVRAIAGIQHIGLGAGYDGIELPPLGLEDVSKY 900
            .:|.||:|::|.::.|||.:.|.:.||.:|..|:.:|||.|.:|:|..|||:...|.||||.|||
 Frog   268 KKNKGLVMVNFHTQFVACQKTANISDVADHFDYISSIAGFQSVGIGGDYDGVNGFPRGLEDPSKY 332

  Fly   901 PELLAALLEDHNWSEEDVAMLAGRNFLRIMETVETVRDYWKRAAIQPIEQ 950
            |.|:..||. ..|.:.::..:...||||:...||.|||  ::..::|.|:
 Frog   333 PSLIQELLR-RGWKDNELEGVLRANFLRVFREVEKVRD--EQIYMKPSEE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44837NP_001287037.1 rDP_like 609..929 CDD:238626 153/325 (47%)
dpep2XP_017948963.1 Peptidase_M19 43..363 CDD:395996 154/333 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 331 1.000 Domainoid score I1158
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 1 1.000 - - FOG0001225
OrthoInspector 1 1.000 - - mtm9558
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.