| Sequence 1: | NP_001285192.1 | Gene: | Lgr4 / 5740505 | FlyBaseID: | FBgn0085440 | Length: | 809 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_848829.2 | Gene: | Lrfn5 / 238205 | MGIID: | 2144814 | Length: | 746 | Species: | Mus musculus |
| Alignment Length: | 272 | Identity: | 78/272 - (28%) |
|---|---|---|---|
| Similarity: | 110/272 - (40%) | Gaps: | 35/272 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 265 LILARNHLHHLKRSDFLNLQKLQELDLRGNRIGNFEAEVFARLPNLEVLYLNENHLKRLDPDRFP 329
Fly 330 RTLLNLHTLSLAYNQIEDIAANTFP--FPRLRYLFLAGNRLSHIRDETFCNLSNLQGLHLNENRI 392
Fly 393 EGFDLEAFACLKNLSSLLLTGNRFQTLDSRVL----KNLTSLDYIYFSWFHLCSAAMNVRVCDPH 453
Fly 454 GDGISSKLHLLDNQILRGSVWVMA-----SIAVVGNLLVLLGRYFY---KSRSNVEHSLYLRHLA 510
Fly 511 ASDFLMGIYLTL 522 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lgr4 | NP_001285192.1 | Ldl_recept_a | 87..124 | CDD:278486 | |
| LRR_RI | <184..397 | CDD:238064 | 48/133 (36%) | ||
| LRR_8 | 188..248 | CDD:290566 | |||
| leucine-rich repeat | 188..211 | CDD:275380 | |||
| leucine-rich repeat | 212..235 | CDD:275380 | |||
| leucine-rich repeat | 238..261 | CDD:275380 | |||
| LRR_8 | 261..320 | CDD:290566 | 23/54 (43%) | ||
| leucine-rich repeat | 262..285 | CDD:275380 | 9/19 (47%) | ||
| LRR_4 | 284..325 | CDD:289563 | 15/40 (38%) | ||
| leucine-rich repeat | 286..309 | CDD:275380 | 8/22 (36%) | ||
| LRR_4 | 308..348 | CDD:289563 | 17/39 (44%) | ||
| leucine-rich repeat | 310..334 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 335..357 | CDD:275380 | 9/23 (39%) | ||
| LRR_8 | 356..416 | CDD:290566 | 16/59 (27%) | ||
| leucine-rich repeat | 358..381 | CDD:275380 | 6/22 (27%) | ||
| LRR_4 | 381..421 | CDD:289563 | 12/39 (31%) | ||
| leucine-rich repeat | 382..405 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 406..427 | CDD:275380 | 6/24 (25%) | ||
| 7tm_1 | 483..741 | CDD:278431 | 13/43 (30%) | ||
| Lrfn5 | NP_848829.2 | LRR 1 | 52..73 | 8/16 (50%) | |
| leucine-rich repeat | 53..76 | CDD:275380 | 9/19 (47%) | ||
| LRR_8 | 55..111 | CDD:338972 | 23/54 (43%) | ||
| LRR 2 | 76..97 | 6/20 (30%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 100..159 | CDD:338972 | 24/60 (40%) | ||
| LRR 3 | 100..121 | 9/21 (43%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 9/23 (39%) | ||
| LRR 4 | 124..145 | 9/20 (45%) | |||
| leucine-rich repeat | 125..148 | CDD:275380 | 9/23 (39%) | ||
| LRR 5 | 148..169 | 6/20 (30%) | |||
| LRR_8 | 149..207 | CDD:338972 | 16/57 (28%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 6/22 (27%) | ||
| LRR 6 | 172..193 | 6/20 (30%) | |||
| leucine-rich repeat | 173..196 | CDD:275380 | 7/22 (32%) | ||
| LRR 7 | 196..217 | 6/20 (30%) | |||
| leucine-rich repeat | 197..215 | CDD:275380 | 5/17 (29%) | ||
| TPKR_C2 | 240..>272 | CDD:387596 | 4/40 (10%) | ||
| Ig_2 | 301..374 | CDD:143241 | 3/6 (50%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 385..416 | ||||
| fn3 | 421..493 | CDD:365830 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||