Sequence 1: | NP_001285192.1 | Gene: | Lgr4 / 5740505 | FlyBaseID: | FBgn0085440 | Length: | 809 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001255400.1 | Gene: | lron-14 / 188075 | WormBaseID: | WBGene00011454 | Length: | 747 | Species: | Caenorhabditis elegans |
Alignment Length: | 334 | Identity: | 86/334 - (25%) |
---|---|---|---|
Similarity: | 133/334 - (39%) | Gaps: | 61/334 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 FSCP----CRGD-------EILCRFQQLTDIPERLPQHDLA-TLDLT----GNNFETIHETFFSE 208
Fly 209 LPDVDSLVLKFCSIREIASHAFDRLADNPLRTLYMDDNKLPHLPEHFFPEGNQLSILILARNHLH 273
Fly 274 HLKRSDFLNLQKLQELDLRGNRIGNFEAEVFARLPNLEVLYLNENHLKRLDPDRFPRTLL----- 333
Fly 334 ---------------NLHTLSLAYNQIEDI------AANTFPFPRLRYLFLAGNRLSHIRDETFC 377
Fly 378 NLSNLQGLHLNENRIEGFDLEAFACLKNLSSLLLTGNRFQTLDSRVLKNLTSLDYIYFSWFHLCS 442
Fly 443 AAMNVRVCD 451 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lgr4 | NP_001285192.1 | Ldl_recept_a | 87..124 | CDD:278486 | |
LRR_RI | <184..397 | CDD:238064 | 64/243 (26%) | ||
LRR_8 | 188..248 | CDD:290566 | 14/64 (22%) | ||
leucine-rich repeat | 188..211 | CDD:275380 | 5/27 (19%) | ||
leucine-rich repeat | 212..235 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 238..261 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 261..320 | CDD:290566 | 19/58 (33%) | ||
leucine-rich repeat | 262..285 | CDD:275380 | 6/22 (27%) | ||
LRR_4 | 284..325 | CDD:289563 | 13/40 (33%) | ||
leucine-rich repeat | 286..309 | CDD:275380 | 8/22 (36%) | ||
LRR_4 | 308..348 | CDD:289563 | 16/59 (27%) | ||
leucine-rich repeat | 310..334 | CDD:275380 | 9/43 (21%) | ||
leucine-rich repeat | 335..357 | CDD:275380 | 9/27 (33%) | ||
LRR_8 | 356..416 | CDD:290566 | 16/59 (27%) | ||
leucine-rich repeat | 358..381 | CDD:275380 | 7/22 (32%) | ||
LRR_4 | 381..421 | CDD:289563 | 11/39 (28%) | ||
leucine-rich repeat | 382..405 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 406..427 | CDD:275380 | 5/20 (25%) | ||
7tm_1 | 483..741 | CDD:278431 | |||
lron-14 | NP_001255400.1 | leucine-rich repeat | 98..119 | CDD:275380 | 6/20 (30%) |
LRR_8 | 119..177 | CDD:290566 | 16/60 (27%) | ||
leucine-rich repeat | 120..143 | CDD:275380 | 5/22 (23%) | ||
LRR_RI | 142..389 | CDD:238064 | 59/218 (27%) | ||
leucine-rich repeat | 144..166 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 167..189 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 190..211 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 212..234 | CDD:275380 | 1/21 (5%) | ||
leucine-rich repeat | 235..261 | CDD:275380 | 9/26 (35%) | ||
LRR_8 | 262..321 | CDD:290566 | 19/71 (27%) | ||
leucine-rich repeat | 263..286 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 287..310 | CDD:275380 | 8/33 (24%) | ||
leucine-rich repeat | 349..404 | CDD:275380 | |||
LRR_8 | 456..515 | CDD:290566 | |||
leucine-rich repeat | 458..481 | CDD:275380 | |||
LRR_4 | 481..520 | CDD:289563 | |||
leucine-rich repeat | 482..504 | CDD:275380 | |||
leucine-rich repeat | 505..526 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24372 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |