Sequence 1: | NP_001285192.1 | Gene: | Lgr4 / 5740505 | FlyBaseID: | FBgn0085440 | Length: | 809 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001333102.1 | Gene: | LRFN5 / 145581 | HGNCID: | 20360 | Length: | 719 | Species: | Homo sapiens |
Alignment Length: | 272 | Identity: | 78/272 - (28%) |
---|---|---|---|
Similarity: | 110/272 - (40%) | Gaps: | 35/272 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 265 LILARNHLHHLKRSDFLNLQKLQELDLRGNRIGNFEAEVFARLPNLEVLYLNENHLKRLDPDRFP 329
Fly 330 RTLLNLHTLSLAYNQIEDIAANTFP--FPRLRYLFLAGNRLSHIRDETFCNLSNLQGLHLNENRI 392
Fly 393 EGFDLEAFACLKNLSSLLLTGNRFQTLDSRVL----KNLTSLDYIYFSWFHLCSAAMNVRVCDPH 453
Fly 454 GDGISSKLHLLDNQILRGSVWVMA-----SIAVVGNLLVLLGRYFY---KSRSNVEHSLYLRHLA 510
Fly 511 ASDFLMGIYLTL 522 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lgr4 | NP_001285192.1 | Ldl_recept_a | 87..124 | CDD:278486 | |
LRR_RI | <184..397 | CDD:238064 | 48/133 (36%) | ||
LRR_8 | 188..248 | CDD:290566 | |||
leucine-rich repeat | 188..211 | CDD:275380 | |||
leucine-rich repeat | 212..235 | CDD:275380 | |||
leucine-rich repeat | 238..261 | CDD:275380 | |||
LRR_8 | 261..320 | CDD:290566 | 23/54 (43%) | ||
leucine-rich repeat | 262..285 | CDD:275380 | 9/19 (47%) | ||
LRR_4 | 284..325 | CDD:289563 | 15/40 (38%) | ||
leucine-rich repeat | 286..309 | CDD:275380 | 8/22 (36%) | ||
LRR_4 | 308..348 | CDD:289563 | 17/39 (44%) | ||
leucine-rich repeat | 310..334 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 335..357 | CDD:275380 | 9/23 (39%) | ||
LRR_8 | 356..416 | CDD:290566 | 16/59 (27%) | ||
leucine-rich repeat | 358..381 | CDD:275380 | 6/22 (27%) | ||
LRR_4 | 381..421 | CDD:289563 | 12/39 (31%) | ||
leucine-rich repeat | 382..405 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 406..427 | CDD:275380 | 6/24 (25%) | ||
7tm_1 | 483..741 | CDD:278431 | 13/43 (30%) | ||
LRFN5 | NP_001333102.1 | LRR 1 | 52..73 | 8/16 (50%) | |
LRR 2 | 76..97 | 6/20 (30%) | |||
LRR 3 | 100..121 | 9/21 (43%) | |||
LRR 4 | 124..145 | 9/20 (45%) | |||
LRR 5 | 148..169 | 6/20 (30%) | |||
LRR 6 | 172..193 | 6/20 (30%) | |||
LRR 7 | 196..217 | 6/20 (30%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 385..414 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 615..694 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |