DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-C and inaF-B

DIOPT Version :10

Sequence 1:NP_001096959.1 Gene:inaF-C / 5740497 FlyBaseID:FBgn0085350 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001162726.1 Gene:inaF-B / 8674114 FlyBaseID:FBgn0259918 Length:81 Species:Drosophila melanogaster


Alignment Length:121 Identity:31/121 - (25%)
Similarity:48/121 - (39%) Gaps:50/121 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GNAASMANLAKIVNLIESNVKSEDVEVLEEAVRGSTGTGSGSSVRLASSSAPRRSACATSYVPKS 77
            |.:|.|||||.:|    ...|.|::.                                   :|||
  Fly     3 GPSALMANLADVV----KEAKDEEIP-----------------------------------MPKS 28

  Fly    78 PQLEEIVFAEPTYTERFARYFVIVIYLCGLCSLGFFLSIYHIFFWDSRMP--PVYK 131
            ...    |...|:     |...:::|:.|:..:|..|::|::|.||||||  ||:|
  Fly    29 NDF----FESKTF-----RLLTLLLYMGGVSGMGLTLAVYYLFIWDSRMPPLPVFK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-CNP_001096959.1 InaF-motif 92..126 CDD:464449 10/33 (30%)
inaF-BNP_001162726.1 InaF-motif 34..68 CDD:464449 11/38 (29%)

Return to query results.
Submit another query.