DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and AT1G03070

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001184896.1 Gene:AT1G03070 / 839581 AraportID:AT1G03070 Length:247 Species:Arabidopsis thaliana


Alignment Length:217 Identity:48/217 - (22%)
Similarity:101/217 - (46%) Gaps:43/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVMPLSMVF---------------TVFLYT 90
            :|...:|:.|.|:..|:..|:......:       ||.|:::.|               |..:..
plant    34 LRWGFIRKVYSIIAFQLLATIAVASTVV-------FVRPIAVFFATTSAGLALWIVLIITPLIVM 91

  Fly    91 C-FYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVIL-IIEILGLMLY--- 150
            | .|.:.  ::| |.||.:|.:.|:..:|  :|.|.....:..|.:...|| .:.:|.|.:|   
plant    92 CPLYYYH--QKH-PVNYLLLGIFTVALAF--AVGLTCAFTSGKVILEAAILTTVVVLSLTVYTFW 151

  Fly   151 SSQKRFRFTQIR----GISIISLIFGLFLLLAYRLNRM-MEVFSAMACTVEAWYIIYDTHYMLCG 210
            :::|.:.|..:.    |..|:.::|.| :.:.:.|.|: :.::..:|..:...||:|||..:: .
plant   152 AAKKGYDFNFLGPFLFGALIVLMVFAL-IQIFFPLGRISVMIYGCLAAIIFCGYIVYDTDNLI-K 214

  Fly   211 RHGYNIGPEEFVYAACNIHCDL 232
            |:.|    :|:::||.:::.|:
plant   215 RYSY----DEYIWAAVSLYLDI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 47/214 (22%)
AT1G03070NP_001184896.1 GAAP_like 5..247 CDD:198411 48/217 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23291
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.