DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and AT4G02690

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_192178.1 Gene:AT4G02690 / 828203 AraportID:AT4G02690 Length:248 Species:Arabidopsis thaliana


Alignment Length:254 Identity:54/254 - (21%)
Similarity:109/254 - (42%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVEKSEV-PGIAVQCDLLLPNGHLQRTYEFDIADVGIRRRLVRRFYGILILQMACTLPC----- 63
            |...|.:| .|::.:..||.|..|         .:..:|...:|:.|.|:..|:..|:..     
plant     6 LPYRKDDVETGVSSRRPLLYPAMH---------ENPELRWGFIRKVYSIIAFQLLATVAVAATVV 61

  Fly    64 ----IELFLKYPLPYNFVMPLSMVFTVFLYTC-FYVWRDWRRHGPFNY-----FVLLLSTLIG-- 116
                |.||.. .......:.:.::.|..:..| .|.:.  ::| |.||     |.|.|:.::|  
plant    62 TVRPIALFFA-TTGLGLALYIVIIITPLIVLCPLYYYH--QKH-PVNYLLLGIFTLALAFVVGLT 122

  Fly   117 -SFNRSVYLLNLVETHWVYIYPVILIIEILGLMLY---SSQKRFRFTQIRGI---SIISLIFGLF 174
             :|.....:|..|         ::..:.:|.|.||   :::|.:.|..:...   ::..|||...
plant   123 CAFTNGKVILESV---------ILTSVVVLSLTLYTFWAARKGYDFNFLGPFLFGALTVLIFFAL 178

  Fly   175 LLLAYRLNRM-MEVFSAMACTVEAWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDL 232
            :.:.:.|.|: :.::..:...:...||:|||..:: .||.|    :|:::||.:::.|:
plant   179 IQILFPLGRVSVMIYGCLVSIIFCGYIVYDTDNLI-KRHTY----DEYIWAAVSLYLDI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 45/214 (21%)
AT4G02690NP_192178.1 BI-1-like 31..247 CDD:412397 46/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23291
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.