DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and BIL4

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_191890.1 Gene:BIL4 / 825506 AraportID:AT3G63310 Length:239 Species:Arabidopsis thaliana


Alignment Length:221 Identity:51/221 - (23%)
Similarity:106/221 - (47%) Gaps:29/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IRRRLVRRFYGILILQMACTLPCIELFLKY--------PLPYNFVMPLSMVFTVFLYTC-FYVWR 96
            :|...:|:.|.|:.:|:..|:......:|.        .....|.:.:.::.|..:..| .|.:.
plant    25 LRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTTTTAGFALYILLILTPLIVMCPLYYYH 89

  Fly    97 DWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVIL-IIEILGLMLYS--SQKR--- 155
              ::| |.||.:|.:.|:..:|  :|.|.....:..|.:..||| .:.::.|.||:  :.||   
plant    90 --QKH-PVNYLLLGIFTVALAF--AVGLTCAFTSGKVILESVILTAVVVISLTLYTFWAAKRGHD 149

  Fly   156 FRFTQ--IRGISIISLIFGLFLLLAYRLNRM-MEVFSAMACTVEAWYIIYDTHYMLCGRHGYNIG 217
            |.|..  :.|..|:.::|. |:.:.:.|.:: :.::..:|..:...||:|||..:: .||.|   
plant   150 FNFLGPFLFGAVIVLMVFS-FIQILFPLGKISVMIYGCLASIIFCGYIVYDTDNLI-KRHSY--- 209

  Fly   218 PEEFVYAACNIHCDLPKGMWRLMKML 243
             :|:::||.:::.|:......|:.:|
plant   210 -DEYIWAAVSLYLDVINLFLSLLTLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 48/207 (23%)
BIL4NP_191890.1 BI-1-like 22..225 CDD:320991 49/210 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23291
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.