DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and faim2

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001072357.1 Gene:faim2 / 779810 XenbaseID:XB-GENE-953203 Length:311 Species:Xenopus tropicalis


Alignment Length:217 Identity:54/217 - (24%)
Similarity:97/217 - (44%) Gaps:39/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVMPLS-----------MVFTVFL--YTCF 92
            :||..:|:.|.||::|:..|:..:.||       .|..|:.           ..:.||.  |...
 Frog    94 VRRGFIRKVYAILMIQLLVTVAVVALF-------TFCDPVKGYIQANPGWYWASYAVFFSTYLVL 151

  Fly    93 YVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGLM-----LYSS 152
            ......||..|:|..:|.:.||     ...|:..::.:.: ....|||.:.|..|:     |:|.
 Frog   152 ACCSGPRRKFPWNLILLCIFTL-----SMAYITGMLSSFY-NTKSVILCLGITALVCMSVTLFSF 210

  Fly   153 QKRFRFTQIRGI----SIISLIFGLFLLLAYRLNR---MMEVFSAMACTVEAWYIIYDTHYMLCG 210
            |.:..||..:|:    |::.|..|:||::......   :..|::.:...|...::.:||. ||.|
 Frog   211 QSKIDFTSCQGVLFVLSMVLLFSGIFLVILIPFQYIPWLHAVYAVIGAIVFTMFLAFDTQ-MLMG 274

  Fly   211 RHGYNIGPEEFVYAACNIHCDL 232
            ...|::.|||:::.|.||:.|:
 Frog   275 SRRYSLSPEEYIFGALNIYLDI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 53/214 (25%)
faim2NP_001072357.1 LFG_like 88..308 CDD:198410 54/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.