DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and tmbim1

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001025668.1 Gene:tmbim1 / 595060 XenbaseID:XB-GENE-984286 Length:347 Species:Xenopus tropicalis


Alignment Length:219 Identity:51/219 - (23%)
Similarity:96/219 - (43%) Gaps:37/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVMPLSMVFTVFL----------YTCF 92
            |..:|...:||.|.|:.:|:..|:..|.:|       .:|.|:    |.|:          |..|
 Frog   127 DKAVRHAFIRRVYAIIAVQLLLTVGIIAIF-------TYVEPV----TSFIRRTPGVYYASYAVF 180

  Fly    93 YV-------WRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGLMLY 150
            :|       ....||..|:|..:|.:.||..:|.... :.:...:..|.|...|..|..:.:.::
 Frog   181 FVTYIVLVCCEGPRRRFPWNIILLAIFTLAMAFMAGT-IASFYSSKAVLISMGITAIVTIIVTIF 244

  Fly   151 SSQKRFRFTQIRG----ISIISLIFGLF--LLLAYRLNRMME-VFSAMACTVEAWYIIYDTHYML 208
            ..|.:..||...|    :.|:..:.|:.  ::||::....:. :::|:...|...::.:||. ::
 Frog   245 CFQTKVDFTSCAGLFAVLGIVMFVTGIVTAIVLAFKYVYWLHMLYAALGAIVFTLFLAFDTQ-LV 308

  Fly   209 CGRHGYNIGPEEFVYAACNIHCDL 232
            .|...:.|.|||:||.|..|:.|:
 Frog   309 IGNRKHTINPEEYVYGALKIYTDI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 49/213 (23%)
tmbim1NP_001025668.1 LFG_like 124..344 CDD:198410 51/219 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.