DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and zgc:110410

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001315301.1 Gene:zgc:110410 / 553618 ZFINID:ZDB-GENE-050522-465 Length:405 Species:Danio rerio


Alignment Length:225 Identity:58/225 - (25%)
Similarity:108/225 - (48%) Gaps:20/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ADVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFV----------MPLSMVFTVFLYTC 91
            :|..|||..:|:.|..|::|:..|:..|..||.:....::|          |.::....:.|..|
Zfish   187 SDAAIRRGFIRKVYLTLMIQLLITVGIICAFLYWETLSDWVKDTYWFTYTMMGVTFALVIVLVCC 251

  Fly    92 FYVWRDWRRHGPFNYFVLLLSTLI-GSFNRSVYLLNLVETHWVYIYPVILIIEILGLMLYSSQKR 155
            .    |.||..|.|:..|.|.|:. |....||.:....|.....:....|:  .|.:.|:|.|.:
Zfish   252 V----DIRRKVPLNFIFLGLFTIAEGCLLGSVVVYYSAEAVLWAVGATALV--SLAMSLFSLQSK 310

  Fly   156 FRFTQIRGI--SIISLIFGLFLLLAYRLNRMMEVF-SAMACTVEAWYIIYDTHYMLCGRHGYNIG 217
            :.||...|.  ::...:|...||.|...::.:.:| :::...:.:.|::.||..:|.|:|.|:|.
Zfish   311 WDFTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFSVYLVIDTQLILGGKHKYSIS 375

  Fly   218 PEEFVYAACNIHCDLPKGMWRLMKMLFFSK 247
            |||:::||.|::.|:......|::::.|.:
Zfish   376 PEEYIFAALNLYIDIVTIFLLLLQLIGFCR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 54/203 (27%)
zgc:110410NP_001315301.1 Bindin 89..>171 CDD:251078
LFG_like 186..402 CDD:198410 57/220 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.