DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and faim2a

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001013536.1 Gene:faim2a / 541391 ZFINID:ZDB-GENE-050320-88 Length:306 Species:Danio rerio


Alignment Length:259 Identity:64/259 - (24%)
Similarity:107/259 - (41%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PGI--AVQCDLLLPNGHLQRTYEFD-----IADVGIRRRLVRRFYGILILQMACTLPCIELF--- 67
            ||.  |...|:..|......:..||     ..|..|||..:|:.:.||::|:..|...:.||   
Zfish    54 PGYSNAYAADMSSPFSDPSSSNSFDGLGSNWEDKNIRRMFIRKVFCILMVQLMVTFSVVSLFTFC 118

  Fly    68 --LKYPLPYNFVMPLSMVFTVF-LYTCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVE 129
              ::..:.||.|..|:...|.. .|.......:.||..|.|..:|.:.||..|:...: |.:...
Zfish   119 EPVRKFVQYNRVFYLTSYMTFMGTYLMLVCSTNARRRYPTNMILLAIFTLAMSYMAGM-LASYHN 182

  Fly   130 THWVYIYPVILIIEILGLMLYSSQKRFRFTQIRG----ISIISLIFGLFLLLAYR------LNRM 184
            |..|.:...|..:..|.:.|:..|.|..||...|    :.::.:|.||.|.....      |:..
Zfish   183 TKVVMLSVGITALVCLAITLFCFQSRVDFTTCHGLLFSLMMVLMITGLLLFFTAPFGYIPWLHTA 247

  Fly   185 MEVFSAMACTVEAWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDLPKGMWRLMKMLFFSKI 248
            ...|.|:..|:   ::.:|.. :|.|...|::.|||.|:.|..::.|:      :...|||.::
Zfish   248 YAGFGALVFTL---FLAFDMQ-LLIGNRRYSLNPEEHVFGAICLYMDV------VYIFLFFLQL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 52/205 (25%)
faim2aNP_001013536.1 LFG_like 83..303 CDD:198410 57/230 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.