DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and tmbim1a

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001005992.2 Gene:tmbim1a / 449819 ZFINID:ZDB-GENE-041010-69 Length:332 Species:Danio rerio


Alignment Length:268 Identity:61/268 - (22%)
Similarity:117/268 - (43%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVLVVEKSEVPGIAVQCDLLLPNGHLQRTYEFDIADVGIRRRLVRRFYGILILQMACTLPCIELF 67
            |:.|:.....|||..........|       |:..||  |...:|:.|.||..|:..|...:.:|
Zfish    85 AMPVIPVMPPPGIGDSEGFTTAEG-------FESTDV--RHSFIRKVYLILAAQLLVTAAVVAIF 140

  Fly    68 L----------KYPLPYNFVMPLSMVFTVFLYTCFYVWRDWRRHGPFNYFVLLLSTLIGSF---N 119
            .          |.|..|.....:..|..:.|..|    :..||..|:|..:|.:.||..||   |
Zfish   141 TFVEPVGLFVRKNPAIYWVSYAIYFVTHIVLVCC----QGPRRRFPWNLLLLAIFTLALSFMTGN 201

  Fly   120 RSVYLLNLVETHWVYIYPVILIIEILGLMLYSSQKRFRFTQIRG----ISIISLIFGLF--LLLA 178
            .:.|    ..|..|::...|.::..:.:.::..|.:..||:..|    :.|:..:.|:.  ::|:
Zfish   202 IASY----YSTRAVFLALAITVVVCVAVTVFCFQTKVDFTKCSGFFCVLGIVVFVTGIITAIVLS 262

  Fly   179 YR----LNRMMEVFSAMACTVEAWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDLPKGMWRL 239
            ::    |:.:.....|:|.|:   ::.|.|. :|.|....:|.|||:|:||.:::.|:.:....|
Zfish   263 FKYVPWLHMLYASIGAIAFTL---FLAYHTQ-LLIGNRKLSISPEEYVFAALSLYVDIVQIFIFL 323

  Fly   240 MKMLFFSK 247
            ::::.:::
Zfish   324 LQIIGYAE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 50/212 (24%)
tmbim1aNP_001005992.2 ARS2 <21..83 CDD:282772
LFG_like 108..328 CDD:198410 56/240 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.