DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and tmbim4

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001004879.1 Gene:tmbim4 / 448209 XenbaseID:XB-GENE-947555 Length:235 Species:Xenopus tropicalis


Alignment Length:229 Identity:53/229 - (23%)
Similarity:101/229 - (44%) Gaps:44/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ADVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFV------MPLSMV---FTVFLYTCF 92
            |.:.||...:::.|.||..|:..|.....|||.......||      :.:|::   .||...|.:
 Frog    23 ASIQIRMDFLKKVYSILTTQILLTTLTAALFLYSKSIQTFVHESPALLLISVIGSLGTVIALTIY 87

  Fly    93 YVWRDWRRHGPFNYFVLL---------LSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGLM 148
                  |:..|.|.::||         ::|.:..::.:|.|...:.|..|:          |||.
 Frog    88 ------RQQHPVNLYLLLAFTAFEAVTVATAVTFYDVAVVLQAFILTTAVF----------LGLT 136

  Fly   149 LYSSQKRFRFTQIRGISIIS----LIFGLFLLLAYRLNRMMEVFSAMACTVEAWYIIYDTHYMLC 209
            .::.|.:..|::. |..:.:    |||..||.|.:....:..:.:|....:...:||:|||.:: 
 Frog   137 AFTFQSKRDFSKF-GAGLFTGLWILIFASFLRLFFYSETVELLIAAAGALLFCGFIIFDTHLLM- 199

  Fly   210 GRHGYNIGPEEFVYAACNIHCDLPKGMWRLMKML 243
                :.:.|||::.|:.|::.|:......|:::|
 Frog   200 ----HKLSPEEYILASVNLYLDIINLFLHLLRIL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 49/211 (23%)
tmbim4NP_001004879.1 GAAP_like 2..233 CDD:198411 53/229 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.