DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and CG9722

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster


Alignment Length:209 Identity:61/209 - (29%)
Similarity:104/209 - (49%) Gaps:26/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IRRRLVRRFYGILILQMACTLPCI---------ELFLKYPLPYNFVMPLSMVFTVFLYTCFYVWR 96
            |||..:|:.|.||:.|:..:|..|         .|.:........|..|.:||::....|.   .
  Fly    50 IRRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSLVALGCN---E 111

  Fly    97 DWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHW--VYIYPVILIIE--ILGLMLYSSQKRFR 157
            |.||..|.|:..|...|:..||     ||.:....:  :.|:..:||..  .|||.|::.|.|:.
  Fly   112 DLRRQTPANFIFLSAFTIAESF-----LLGVAACRYAPMEIFMAVLITASVCLGLTLFALQTRYD 171

  Fly   158 FTQIRGI----SIISLIFGLFLLLAYRLNRMMEVFSAMACTVEAWYIIYDTHYMLCGRHGYNIGP 218
            ||.:.|:    .||.|.||:..:.... :.:..::::::..:.:.|::|||..|:.|:|.|:|.|
  Fly   172 FTVMGGLLVSCLIILLFFGIVTIFVGG-HMVTTIYASLSALLFSVYLVYDTQLMMGGKHRYSISP 235

  Fly   219 EEFVYAACNIHCDL 232
            ||:::||.||:.|:
  Fly   236 EEYIFAALNIYMDV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 60/206 (29%)
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 61/209 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.