DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and grinab

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001295540.1 Gene:grinab / 394183 ZFINID:ZDB-GENE-040426-1367 Length:337 Species:Danio rerio


Alignment Length:228 Identity:55/228 - (24%)
Similarity:111/228 - (48%) Gaps:37/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVMPLSMV----FTVFLYTCFYV--WRDWR 99
            |||..:|:.:.:|.||:|.|...:.:|...|....|||..|..    :.|||...|.:  ..::|
Zfish   123 IRRVFIRKVFSVLSLQLAITTAFVAIFTFEPHVKLFVMQNSWTYWVGYLVFLVPYFVILCCGEFR 187

  Fly   100 RHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGL--------MLYSSQKRF 156
            |..|:|...|.:.||..|     |::.::.:    .|...::|..:|:        :::|.|.::
Zfish   188 RKHPWNLICLSVLTLAMS-----YMVGVISS----FYDTDIVIMAIGITVVVCFTVIIFSMQTKY 243

  Fly   157 RFTQIRGI----SIISLIFGLFLLLAYRLNRMME-VFSAMACTVEAWYIIYDTHYMLCGRHGYNI 216
            .||...|:    .|:..:||:..::.|  :::|: ::|.:...:...::..||. :|.|....::
Zfish   244 DFTSCYGVLFVCGIVLFVFGILCIIFY--SKIMDLIYSTLGALLFTCFLAVDTQ-LLLGNKNLSL 305

  Fly   217 GPEEFVYAACNIHCDLPKGMWRLMKMLFFSKIV 249
            .|||:::|:.|::.|:      :...||..:|:
Zfish   306 SPEEYIFASLNLYLDI------IQIFLFILRIL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 51/208 (25%)
grinabNP_001295540.1 LFG_like 119..333 CDD:198410 55/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.