DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and BI-1

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_648205.1 Gene:BI-1 / 38936 FlyBaseID:FBgn0035871 Length:245 Species:Drosophila melanogaster


Alignment Length:152 Identity:32/152 - (21%)
Similarity:64/152 - (42%) Gaps:36/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GPFNYFV------LLLSTLIGSFNR--SVYLLNLVETHWVYIYPVILIIEILGLMLYSSQKRFRF 158
            ||...::      ::||.|.|:|..  |:.|..|:.....|:|...:::.::..|..        
  Fly   103 GPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGMLVSVINTMAL-------- 159

  Fly   159 TQIRGISIISLIFGLFLLLAYRLNRMMEVFSAMACTVEAWYIIYDTHYML--CGRHGYNIGPEEF 221
                 :|:.:::|..:.:...:|  .:.||      |.|.:|:|||..::  |..     |..:.
  Fly   160 -----LSLFNMVFKSYFVQVTQL--YVGVF------VMAAFIVYDTQNIVEKCRN-----GNRDV 206

  Fly   222 VYAACNIHCDLPKGMWRLMKML 243
            |..|.::..|:.....||:.:|
  Fly   207 VQHALDLFFDVLSMFRRLLIIL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 28/138 (20%)
BI-1NP_648205.1 BI-1 21..233 CDD:198412 32/152 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.