DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and Tmbim4

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_954547.1 Gene:Tmbim4 / 362884 RGDID:735173 Length:238 Species:Rattus norvegicus


Alignment Length:223 Identity:54/223 - (24%)
Similarity:97/223 - (43%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ADVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVM------------PLSMVFTVFLY 89
            |.|.||...:|:.|.||.||:..|.....|||.:.....||.            .|.::|.:.|:
  Rat    26 ASVHIRMAFLRKVYSILSLQVLLTTVTSALFLYFETLRTFVHDSPALIVVFALGSLGLIFALTLH 90

  Fly    90 TCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGLMLYSSQK 154
                     |...|.|.::|...||..:...:. ::...:.|.|....::.....|||..|:.|.
  Rat    91 ---------RHTHPLNLYLLFAFTLSEALTVAT-VVTFYDGHLVLHAFILTAAVFLGLTAYTLQS 145

  Fly   155 RFRFTQIRGISIISLIFGL----FLLLAYRLNRMMEVFSAMACTVEAWYIIYDTHYMLCGRHGYN 215
            :..|::. |..:.:.::.|    ||.:.:....:..|.:::...:...:||||||.::     :.
  Rat   146 KRDFSKF-GAGLFACLWILCLAGFLKVFFYSQTVELVLASLGALLFCGFIIYDTHSLM-----HR 204

  Fly   216 IGPEEFVYAACNIHCDLPKGMWRLMKML 243
            :.|||:|.||.:::.|:......|:|.|
  Rat   205 LSPEEYVLAAISLYLDIINLFLHLLKFL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 48/205 (23%)
Tmbim4NP_954547.1 GAAP_like 6..236 CDD:198411 54/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23291
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.