DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and Tmbim7

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001034701.2 Gene:Tmbim7 / 362319 RGDID:1306626 Length:303 Species:Rattus norvegicus


Alignment Length:242 Identity:66/242 - (27%)
Similarity:114/242 - (47%) Gaps:42/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AVQC--DLLLPNGHLQRTYEFDIADVGIRRRLVRRFYGILILQMACTLPCIELF----------L 68
            |||.  |...||..:..:..|:  :..||:..:.:.:.:|..|:..|...|.:|          :
  Rat    66 AVQISEDATPPNESVNLSGPFE--NTSIRKGFIVKVFVVLSAQLLITAAIISIFVFCEAVRKWII 128

  Fly    69 KYPLPYNFVMPLSMVFTVFLYTCFYVWRDWRRHGPFNYFVLLLST-----LIGSFNRSVYLLNLV 128
            ..|.....::|..::..|.|..|    ||.||..|.||.:|:..|     |:||.  ||: ....
  Rat   129 AMPWFMYALLPAVLIVIVILACC----RDIRRQVPANYILLVFFTILEGLLLGSM--SVF-YKAD 186

  Fly   129 ETHWV--YIYPVILIIEILGLMLYSSQKRFRFTQIRGI----SIISLIFGLFLLL--AYRLNRMM 185
            |..|.  ....|.|:     |.|::.|.::.||.:.|:    :.:.:|:|:..|:  :|.|:.  
  Rat   187 EILWATGATTAVTLV-----LTLFALQTKWDFTLLNGMLFVFTSVLVIYGIVTLVVRSYWLHL-- 244

  Fly   186 EVFSAMACTVEAWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDL 232
             |:||:...:.:.|::.|...|:.||:.|.|.|||:::||.||:.|:
  Rat   245 -VYSALGTLLFSMYLVMDVQMMVGGRYHYEIDPEEYIFAALNIYVDI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 58/212 (27%)
Tmbim7NP_001034701.2 LFG_like 85..302 CDD:198410 60/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.