DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and Tmbim1

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001007714.1 Gene:Tmbim1 / 316516 RGDID:1359409 Length:309 Species:Rattus norvegicus


Alignment Length:223 Identity:53/223 - (23%)
Similarity:97/223 - (43%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EFDIADVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVMPLS-----------MVFTV 86
            |:|  |..:|...:::.|.|:.:|:..|:..|.:|       .||.|:|           :.:.|
  Rat    86 EWD--DRKVRHTFIQKVYCIISVQLLITVAIIAVF-------TFVEPVSEYVRSNVAVYYVSYAV 141

  Fly    87 FL--YTCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGLML 149
            |:  |......:..||..|:|..:|.:.||...|.... :.::.||..|.|..:|..:..:.:.:
  Rat   142 FIVTYLILVCCQGPRRRFPWNIILLTIFTLALGFMTGA-ISSMYETKAVIIAMIITAVVSISVTI 205

  Fly   150 YSSQKRFRFTQIRG----ISIISLIFG------LFLLLAYRLNRMMEVFSAMACTVEAWYIIYDT 204
            :..|.:..||...|    :.|:..:.|      ||....|.|:.:.....|:..|:   ::.|||
  Rat   206 FCFQTKVDFTSCTGLICVLGIVLAVTGAVTSVVLFFEYIYWLHMVYAGLGAICFTL---FLAYDT 267

  Fly   205 HYMLCGRHGYNIGPEEFVYAACNIHCDL 232
            ..:| |...:.|.||:::..|..|:.|:
  Rat   268 QLVL-GNRKHTISPEDYITGALQIYTDI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 49/212 (23%)
Tmbim1NP_001007714.1 LFG_like 87..306 CDD:198410 52/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.