DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and GRINA

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_000828.1 Gene:GRINA / 2907 HGNCID:4589 Length:371 Species:Homo sapiens


Alignment Length:214 Identity:54/214 - (25%)
Similarity:109/214 - (50%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVMPLSMVFTVFL-YTCFYV------- 94
            |..||:..:|:.:.:|.||::.||..:.:|........||.  ..|:|.:: |..|::       
Human   154 DKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVR--ENVWTYYVSYAVFFISLIVLSC 216

  Fly    95 WRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGL--------MLYS 151
            ..|:||..|:|  ::.||.|..|.:   |::.::.:    .|....:|..:|:        :::|
Human   217 CGDFRRKHPWN--LVALSVLTASLS---YMVGMIAS----FYNTEAVIMAVGITTAVCFTVVIFS 272

  Fly   152 SQKRFRFTQIRGISIISLI--FGLFLLLAYRLNRMME-VFSAMACTVEAWYIIYDTHYMLCGRHG 213
            .|.|:.||...|:.::|::  |...:|..:..||::| |::::...:...::..||. :|.|...
Human   273 MQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQ-LLLGNKQ 336

  Fly   214 YNIGPEEFVYAACNIHCDL 232
            .::.|||:|:||.|::.|:
Human   337 LSLSPEEYVFAALNLYTDI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 52/208 (25%)
GRINANP_000828.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..145
Pro-rich <43..139 CDD:373673
LFG_like 151..367 CDD:198410 54/214 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.