DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and Grina

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_695220.4 Gene:Grina / 266668 RGDID:628873 Length:348 Species:Rattus norvegicus


Alignment Length:214 Identity:53/214 - (24%)
Similarity:108/214 - (50%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVMPLSMVFTVFL-YTCFYV------- 94
            |..||:..:|:.:.:|.||::.||..:.:|........||.  :.|:|.:: |..|::       
  Rat   131 DKSIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVR--ANVWTYYVSYAIFFISLIVLSC 193

  Fly    95 WRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGL--------MLYS 151
            ..|:||..|:|...|.:.|:..|     |::.::.:    .|....:|..:|:        :::|
  Rat   194 CGDFRRKHPWNLVALSILTISLS-----YMVGMIAS----FYNTEAVIMAVGITTAVCFTVVIFS 249

  Fly   152 SQKRFRFTQIRGISIISLI--FGLFLLLAYRLNRMME-VFSAMACTVEAWYIIYDTHYMLCGRHG 213
            .|.|:.||...|:.::|::  |...:|..:..||::| |::::...:...::..||. :|.|...
  Rat   250 MQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQ-LLLGNKQ 313

  Fly   214 YNIGPEEFVYAACNIHCDL 232
            .::.|||:|:||.|::.|:
  Rat   314 LSLSPEEYVFAALNLYTDI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 51/208 (25%)
GrinaNP_695220.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
Pro-rich <16..126 CDD:291893
Bindin 24..>105 CDD:251078
LFG_like 131..344 CDD:198410 53/214 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.