DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and Faim2

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_653357.1 Gene:Faim2 / 246274 RGDID:628744 Length:316 Species:Rattus norvegicus


Alignment Length:232 Identity:61/232 - (26%)
Similarity:110/232 - (47%) Gaps:35/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PNGH--LQRTYEFDIADVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVM-------- 78
            |.||  |..|:.:|  |..:|:..:|:.|.||::|:..||..:.||....:..::|.        
  Rat    81 PAGHHELFSTFSWD--DQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWA 143

  Fly    79 PLSMVFTVFL-YTCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHW----VYIYPV 138
            ..::.|..:| ..|   ....|||.|:|..:|.:.||     ...||..::.:::    |.:...
  Rat   144 SYAVFFATYLTLAC---CSGPRRHFPWNLILLTIFTL-----SMAYLTGMLSSYYNTTSVLLCLG 200

  Fly   139 ILIIEILGLMLYSSQKRFRFTQIRGISIISLIFGLF---LLLAYRL-----NRMMEVFSAMACTV 195
            |..:..|.:.::|.|.:|.||...|:..: |:..||   ||||..|     ..:..|::.:...|
  Rat   201 ITALVCLSVTIFSFQTKFDFTSCHGVLFV-LLMTLFFSGLLLAILLPFQYVPWLHAVYAVLGAGV 264

  Fly   196 EAWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDL 232
            ...::.:||. :|.|...:::.|||:::.|.||:.|:
  Rat   265 FTLFLAFDTQ-LLMGNRRHSLSPEEYIFGALNIYLDI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 53/210 (25%)
Faim2NP_653357.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
LFG_like 92..312 CDD:198410 56/221 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.