DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and tmbi-4

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_509543.2 Gene:tmbi-4 / 181150 WormBaseID:WBGene00006479 Length:276 Species:Caenorhabditis elegans


Alignment Length:251 Identity:47/251 - (18%)
Similarity:101/251 - (40%) Gaps:55/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VQCDLLLPN--GHLQRTYEFDIADVGIRRRLVRRFYGILILQMACTLP-CIELF----------- 67
            |..|.:||.  |...|.         ||...:|:..||:..|:..|:. |..::           
 Worm    52 VDADGILPGCVGKANRM---------IRIAFLRKVLGIVGFQLLFTIGICAAIYNIPNSNQLLQK 107

  Fly    68 ---LKYPLPYNFVMPLSMVFTVFLYTCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVE 129
               :.:|   |.:..::::..:.:|.         |..|.||.:|...|.:.:..... ::.|.|
 Worm   108 HAWIVFP---NLLGSIALIIALHVYA---------REVPLNYVLLAAFTAVQAVTMGC-VVTLFE 159

  Fly   130 THWVYIYPVILIIEILGLMLYSSQKRFRFT----QIRGISIISLIFGLF--LLLAYRLNRMMEVF 188
            ...|....||..:.:..|..|:.|.:..|:    .:..:..:.|..|:|  ..::..:|.::.||
 Worm   160 AKVVLEAAVITGLVVASLFAYTLQNKRDFSVGYASMGSLLCVLLWAGIFQMFFMSPAVNFVINVF 224

  Fly   189 SA-MACTVEAWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDLPKGMWRLMKML 243
            .| :.|.:    ::.|...::     |...||:::.|..:::.|:.....|:::::
 Worm   225 GAGLFCVL----LVIDLDMIM-----YRFSPEDYICACVSLYMDILNLFIRILQIV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 39/211 (18%)
tmbi-4NP_509543.2 GAAP_like 43..275 CDD:198411 47/251 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.