DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and tag-120

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_505501.1 Gene:tag-120 / 179362 WormBaseID:WBGene00006470 Length:244 Species:Caenorhabditis elegans


Alignment Length:231 Identity:50/231 - (21%)
Similarity:98/231 - (42%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PNGHLQRTYEFDIADVGIRRRLVRRFYGILILQMACTLP-CIELFLKYPLP---------YNFVM 78
            |:|    .|....:...:|...||:.:.::.:..|.|.. |:...:..|..         |...:
 Worm    14 PDG----KYNLHFSSQTVRAAFVRKVFMLVTIMFAITAAFCVIPMVSEPFQDWVKNNFWVYFIAI 74

  Fly    79 PLSMVFTVFLYTCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIE 143
            .:.:|..:.|..|    .:.||..|.|..:|.:.||      |..::.:..|....:..|::.:.
 Worm    75 IVFLVVAIALSCC----GNLRRQFPVNIILLTIFTL------SAAVMTMFVTACYNVQSVLICLC 129

  Fly   144 IL-----GLMLYSSQKRFRFTQIRGI----SIISLIFGLFLL---LAYRLNRMMEVFSAMACTVE 196
            |.     .::::|.:.:...|...||    |::...||:|.|   ||:....:..|:|.:|..:.
 Worm   130 ITTVCSGSVIIFSMKTKSDLTSKMGIAFMLSMVLFSFGIFALIFTLAFNWQFLYSVYSGLAALLM 194

  Fly   197 AWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDL 232
            .:|:..|...::.||. |.:.||::::||..|..|:
 Worm   195 MFYLAIDVQLLMGGRK-YELSPEDYIFAAMEIFLDI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 46/211 (22%)
tag-120NP_505501.1 LFG_like 21..241 CDD:198410 47/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.