DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and xbx-6

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001379309.1 Gene:xbx-6 / 179361 WormBaseID:WBGene00009580 Length:296 Species:Caenorhabditis elegans


Alignment Length:246 Identity:60/246 - (24%)
Similarity:108/246 - (43%) Gaps:38/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PNGHLQRTYEFDIADVGIRRRLVRRFYGILILQMACTLPCIELFLKYPLPYNFVMPLSMV---FT 85
            |:|    .|.|..:|..:|...||:.:.::.: |.|.:..:.:     :|:.....:.||   ..
 Worm    66 PDG----KYSFQFSDKTVRAAFVRKVFSLVFI-MLCIVAAVTV-----IPWVHDDTMRMVRRNSA 120

  Fly    86 VFL--YTCFYV-------WRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILI 141
            ::|  |..|:|       ....||..|.|..|..:.||.    .||..:.:...|...:..:.|.
 Worm   121 LYLGSYVIFFVTYLSLVCCEGVRRKFPVNLIVTGIFTLA----TSVMTMVISAHHDANVVLLALA 181

  Fly   142 IEI---LGLMLYSSQKRFRFTQIRG----ISIISLIFGLFLLLA---YRLNRMMEVFSAMACTVE 196
            |.|   ..:::.:||.:|..|...|    ||:..:.|||.:::.   :::..:|.|::.....:.
 Worm   182 ICIGCTFSIVIVASQTKFDLTAHMGYILIISMCFMFFGLVVVICSMFFKIKFLMMVYALGGALIM 246

  Fly   197 AWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDLPKGMWRLMKMLFFSK 247
            ..|:..|.. ||.|...|.|.|||:::|:..|..|:.:..|.|:. ||.|:
 Worm   247 MLYLFLDVQ-MLMGGKKYEISPEEYIFASVQIFIDIVQMFWFLLS-LFGSR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 49/211 (23%)
xbx-6NP_001379309.1 LFG_like 74..293 CDD:198410 54/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.