DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and grina

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001120085.1 Gene:grina / 100145094 XenbaseID:XB-GENE-5740104 Length:286 Species:Xenopus tropicalis


Alignment Length:232 Identity:59/232 - (25%)
Similarity:106/232 - (45%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YEFDI------ADVGIRRRLVRRFYGILILQMACT--LPCIELFLK--------YPLPYNFVMPL 80
            |.|.:      ::..|||..:|:.|..|.:|:|.|  |.|:.:|.|        ||.....:.|.
 Frog    55 YTFGVVGSSPFSESAIRRAFIRKVYLTLAMQLALTVGLICMFIFWKRLKNWVQEYPYIVYALCPA 119

  Fly    81 SMVFTVFLYTCFYVWRDWRRHGPFNYFVL---------LLSTLIGSFNRSVYLLNLVETHWVYIY 136
            .::..:.|..|..|    ||..|:|:..|         :|.|:...|:....:       |.   
 Frog   120 IIILALVLACCQQV----RRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVM-------WA--- 170

  Fly   137 PVILIIEILGLMLYSSQKRFRFTQIRG----ISIISLIFGLF--LLLAYRLNRMMEVFSAMACTV 195
            ....|:..|||.:::.|.::.||.:.|    ..::.|.||:.  :|.:..||   .|::::...:
 Frog   171 GGATIVVTLGLTIFALQTKWDFTMLSGGLCVALLVLLCFGILCGILRSMYLN---IVYASIGTFI 232

  Fly   196 EAWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDL 232
            ...|::.||..::.|:|.|.:.|||:::||.||:.|:
 Frog   233 FGMYLVVDTQLIVGGKHRYAVSPEEYIFAALNIYLDI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 56/214 (26%)
grinaNP_001120085.1 DUF4526 <4..>55 CDD:291688 59/232 (25%)
LFG_like 64..281 CDD:198410 57/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.