DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34430 and si:ch211-284o19.8

DIOPT Version :9

Sequence 1:NP_001097222.1 Gene:CG34430 / 5740489 FlyBaseID:FBgn0085459 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_001341582.3 Gene:si:ch211-284o19.8 / 100007937 ZFINID:ZDB-GENE-070912-289 Length:300 Species:Danio rerio


Alignment Length:264 Identity:65/264 - (24%)
Similarity:120/264 - (45%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VEKSE--VPGIAVQCDLLLPNGHLQRTYEFDIADVGIRRRLVRRFYGILILQMACTLPCIELF-- 67
            |.|:|  .|..||    |.|..|......||  |..:::..:|:.:.::.:|:..|...:.:|  
Zfish    55 VNKTEETSPETAV----LPPEEHQVFVSAFD--DNKVQKAFIRKVFSVVTIQLLVTFTVVCVFTF 113

  Fly    68 ---LKYPLPYNFVMPLS--MVFTVFLYTCFYVWRDWRRHGPFNYFVLLLSTLIGSFNRSVYLLNL 127
               :|..:..|..:.:|  :||.| :..|..|...:.|..|:|...|.:.||..|     |::..
Zfish   114 SKTVKEAVQKNIWIYISSYIVFMV-VALCLSVSSTFSRKHPWNLVGLSMVTLSLS-----YMVGT 172

  Fly   128 VETHWVYIYPVILIIEILG--------LMLYSSQKRFRFTQIRGI----SIISLIFGLFLLLAYR 180
            |.::    :....:|..||        ::::|:|.|..||...|:    ||..|:||.|.:..|.
Zfish   173 VASY----HNTTAVIIALGSTLVISFTIIIFSAQTRLDFTICNGVLLILSIDLLMFGFFSIFFYS 233

  Fly   181 LNRMMEVFSAMACTVEAWYIIYDTHYMLCGRHGYNIGPEEFVYAACNIHCDLPKGMWRLMKMLFF 245
             :.:..|:..:...:.|.::..|.. ::.||..|::.|||:::||..|:.|:      :|..|:.
Zfish   234 -SVLQIVYGCLGALLYALFLAVDCQ-LVMGRQKYSLDPEEYIFAALIIYLDI------IMIFLYI 290

  Fly   246 SKIV 249
            ..|:
Zfish   291 LMIL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34430NP_001097222.1 BI-1-like 41..231 CDD:294323 49/208 (24%)
si:ch211-284o19.8XP_001341582.3 LFG_like 79..295 CDD:198410 56/236 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.