DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34263 and Fstl1

DIOPT Version :10

Sequence 1:NP_001097459.1 Gene:CG34263 / 5740488 FlyBaseID:FBgn0085292 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_077345.1 Gene:Fstl1 / 79210 RGDID:68955 Length:306 Species:Rattus norvegicus


Alignment Length:50 Identity:20/50 - (40%)
Similarity:26/50 - (52%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CSAITNCDPF-LPVCASSTNEHQFFYSICEMLLDACLTGKDWKPDYFNHC 80
            |..|..|.|. .|||.|:   .:.:.:.||:..||||||...:.||..||
  Rat    50 CLCIEQCKPHKRPVCGSN---GKTYLNHCELHRDACLTGSKIQVDYDGHC 96

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG34263NP_001097459.1 None