DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34308 and AT2G44410

DIOPT Version :10

Sequence 1:NP_001097770.3 Gene:CG34308 / 5740483 FlyBaseID:FBgn0085337 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_181969.2 Gene:AT2G44410 / 819048 AraportID:AT2G44410 Length:413 Species:Arabidopsis thaliana


Alignment Length:66 Identity:19/66 - (28%)
Similarity:32/66 - (48%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EEEDSWMNSYYTCLVCMQTAESPRVSFCGHHFCSQCIYNWIRSQKYQAKCPYCQSLIGENTLITI 86
            |:..|....::.|.:|::.||.|.::.|||.||..|.|..........:||.|...:.:..:|.|
plant   113 EKTSSVPGGFFDCNICLEKAEDPILTCCGHLFCWGCFYQLPLIYLNIKECPVCDGEVTDAEVIPI 177

  Fly    87 H 87
            :
plant   178 Y 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34308NP_001097770.3 RING_Ubox 32..76 CDD:473075 15/43 (35%)
AT2G44410NP_181969.2 RING_Ubox 123..179 CDD:473075 17/56 (30%)

Return to query results.
Submit another query.