DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34308 and pex10

DIOPT Version :10

Sequence 1:NP_001097770.3 Gene:CG34308 / 5740483 FlyBaseID:FBgn0085337 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001005994.1 Gene:pex10 / 449821 ZFINID:ZDB-GENE-041010-71 Length:318 Species:Danio rerio


Alignment Length:85 Identity:20/85 - (23%)
Similarity:36/85 - (42%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KDKRN--PNYSGGNSGEEEDSWMNSYYTCLVCMQTAESPRVSFCGHHFCSQCIYNWIRSQKYQAK 70
            |..||  |::....|.....       .|::|::...:...:.|||.||.:||..|..::.   :
Zfish   244 KQHRNLLPSHQVSQSSSRTS-------RCILCLEERRNTTSTPCGHLFCWECITEWCNTKN---E 298

  Fly    71 CPYCQSLIGENTLITIHHAK 90
            ||.|:.....:.|:.:...|
Zfish   299 CPLCREKFQPHRLVYLRSYK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34308NP_001097770.3 RING_Ubox 32..76 CDD:473075 13/43 (30%)
pex10NP_001005994.1 Pex2_Pex12 18..237 CDD:398431
RING-HC_PEX10 263..314 CDD:438190 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.