DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41378 and AT4G12870

DIOPT Version :10

Sequence 1:NP_001163836.1 Gene:CG41378 / 5740475 FlyBaseID:FBgn0085638 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_193023.2 Gene:AT4G12870 / 826899 AraportID:AT4G12870 Length:229 Species:Arabidopsis thaliana


Alignment Length:199 Identity:59/199 - (29%)
Similarity:97/199 - (48%) Gaps:15/199 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LVCLFIVVLWYYPVPVLTSQLHGGALMKVVVTVYYEALCPDSKYFLTKQLLPTF-KIAKSIMEVK 81
            ||.....||:.:...::|     |...||.:.:|||:|||..:.|:..:|:..| ....:|.:||
plant    10 LVFFACFVLFTFSHKLVT-----GESDKVELNLYYESLCPGCQSFIVDELVKVFDSDLDTITDVK 69

  Fly    82 LAPYGKAKTKEHNGKITFDCQHGPIECQANIYHACAAEIIEDPLLRLEVATCMIMDNHSPQEAMN 146
            |.|:|.||.   :..:|..||||..||:.|...||....:.:|..:.:...| :.:|....|  :
plant    70 LVPFGYAKV---SNNLTVICQHGEEECKLNALEACVINTLPNPKSQYKFIRC-VENNTDNWE--S 128

  Fly   147 KCTSQINFDDSVIQNCFESYRGVDLLKVIGESTNSLRPPITFIPTITIDGSQGRQESILKDLLSE 211
            .|..... ::..|.:|:.|.....|:....:.|:||:|...|:|.:||:...  ..:.|.||:.:
plant   129 SCLKGYG-NEKAINDCYNSDLSKKLILGYAKQTSSLKPKHEFVPWVTINSKP--LYTKLDDLVGQ 190

  Fly   212 VCKA 215
            ||||
plant   191 VCKA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41378NP_001163836.1 GILT 49..148 CDD:460853 31/99 (31%)
AT4G12870NP_193023.2 GILT 37..132 CDD:460853 32/100 (32%)

Return to query results.
Submit another query.