DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG34409

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:289 Identity:63/289 - (21%)
Similarity:112/289 - (38%) Gaps:98/289 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIV-VALCASL 95
            |.:.||..:|.|             |:|.::::.|::|:|||:.:    ::|...:. |.|.:..
  Fly   269 YRNRSSSRISFR-------------CSGSLISSNHIVTAAHCVVN----LVSDLELSHVRLGSQD 316

  Fly    96 FKTPESEEFVVDIHNMIIHPYYHRNQH-NDIAIIKLKR--------YVKLDGHHLAPVVLG---- 147
            ..||.:      |..:|:||.|.:.:: ||||::::..        .:..:|    |:.||    
  Fly   317 GATPFA------IEQVIVHPNYDQPKYANDIALLRINSTNGTFTPICLPFNG----PITLGNRLI 371

  Fly   148 ----------------NSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKS 196
                            |||::..|...      |||      |..:.:||.     ..|.....|
  Fly   372 GQIGVAAGWSIGSTENNSSMDPSNSTA------GVR------FIRLPIVNT-----TSCAIAYAS 419

  Fly   197 L-------MAARPENEDLICVKSTE-KQMCTTDFGGPLFCDGQ--LYG----------IALGSIN 241
            |       :...|.:   :|.:... ..:|..|.|||...||.  ::|          :|.|...
  Fly   420 LSENFQQPIVITPNH---LCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTL 481

  Fly   242 CS-SPDPVFFSDVSFYNSWVTKIISEAVD 269
            |. :..|..::.||.::.|:.:.|:|..|
  Fly   482 CGVTTIPGVYTLVSSFSDWILRSIAEGSD 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 59/278 (21%)
Tryp_SPc 38..263 CDD:304450 57/275 (21%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 59/278 (21%)
Tryp_SPc 252..501 CDD:238113 59/278 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.