DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Mcpt10

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_058842.2 Gene:Mcpt10 / 54269 RGDID:3063 Length:248 Species:Rattus norvegicus


Alignment Length:273 Identity:70/273 - (25%)
Similarity:116/273 - (42%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLAYFLLLKIALVLPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNR 65
            |.|..|.|:.|   ||.|....:| .:...:..|...|:.||   .:.:.....|:|.|.::...
  Rat     1 MFLFLFFLVAI---LPVNTEGGEI-IWGTESKPHSRPYMASL---MFYYGNSYRHYCGGFLVAKD 58

  Fly    66 HVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIAIIKL 130
            .|:|:|||    ||     ..|.|.|.|...|..|..:.:..:.......|...::.|||.::||
  Rat    59 IVMTAAHC----NG-----SNIKVTLGAHNIKKQEKTQVIAVVKAKPHENYDRHSRFNDIMLLKL 114

  Fly   131 KRYVKLDGHHLAPVVLGNSS--LEVGNDCKTIGGIFGVRRQRFGSFHSMLL------VNVELRPF 187
            :|..:|:| .:..:.|..|.  ::.|..| |:.|        :|...:..|      ||:|::..
  Rat   115 ERKAQLNG-AVKTIALPRSQDWVKPGQVC-TVAG--------WGCLANCSLSNTLQEVNLEVQEG 169

  Fly   188 DECLKVKKSLMAARPENEDL-ICVKSTEKQMCT--TDFGGPLFCDGQLYGIALGSINCSSPDPVF 249
            .:|..:      :|..|:.: :||.:..:...|  .|.|||..|||...||....: |:...|..
  Rat   170 QKCEDM------SRNYNDSIQLCVGNPSEGKATGKGDSGGPFVCDGVAQGIVSYRL-CTGTLPRV 227

  Fly   250 FSDVSFYNSWVTK 262
            |:.:|.:..|:.|
  Rat   228 FTRISSFIPWIQK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 59/241 (24%)
Tryp_SPc 38..263 CDD:304450 60/236 (25%)
Mcpt10NP_058842.2 Tryp_SPc 21..241 CDD:238113 62/250 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.