DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Cfd

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:248 Identity:60/248 - (24%)
Similarity:107/248 - (43%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFK 97
            :|...|:.|::.       ...|.|.|.::..:.||::|||:   :|| ...:.:.|.|.|....
  Rat    34 AHARPYMASVQV-------NGTHVCGGTLVDEQWVLSAAHCM---DGV-TKDEVVQVLLGAHSLS 87

  Fly    98 TPESEEFVVDIHNMIIHPYYHRNQ-HNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEV--GNDCKT 159
            :||..:.:.|:.::::||....:. .:|:.:.||.....| |.|:.|:.|.....||  |..|..
  Rat    88 SPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASL-GPHVRPLPLQREDREVKPGTLCDV 151

  Fly   160 IGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPEN----------EDLICVKSTE 214
            .|  :||            :.:...|| |...::..|:|.....|          ::::|.:|..
  Rat   152 AG--WGV------------VTHAGRRP-DVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNR 201

  Fly   215 KQMCTTDFGGPLFCDGQLYGIAL-GSINCSS-PDPVFFSDVSFYNSWVTKIIS 265
            :..|..|.||||.|...:..:.. ||..|.: ..|..|:.|:.|..|:..::|
  Rat   202 RDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/241 (24%)
Tryp_SPc 38..263 CDD:304450 58/239 (24%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 59/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.