DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG11842

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:251 Identity:64/251 - (25%)
Similarity:106/251 - (42%) Gaps:74/251 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASL-FKT----PESEEFVVDIHNMIIHP 115
            ||.|.::::|||||:|||.....|      .:.:|....| |.|    .:.|:|  |:.:...||
  Fly   102 FCGGTLISDRHVLTAAHCHYSPQG------SVNIARLGDLEFDTNNDDADPEDF--DVKDFTAHP 158

  Fly   116 -YYHRNQHNDIAIIKLKRYVKL-DGHHLAPVV-----LGNSSLEVGNDCKTIGGIFGVRRQRFGS 173
             :.:...:|||::::|.|.|.. |..|.|.:.     ||.|.:.:|                :| 
  Fly   159 EFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIG----------------WG- 206

  Fly   174 FHSMLLVNVELRPFDECLKVKK----------SLMAARPENEDL---------ICVKSTE-KQMC 218
                   .:|:.|..|..|::|          .:.|.|  |::|         :|:.|.| |..|
  Fly   207 -------QLEIVPRTENKKLQKVKLYNYGTRCRITADR--NDELPEGYNATTQLCIGSNEHKDTC 262

  Fly   219 TTDFGGPLF-------CDGQLYGIALGSINCSSPD-PVFFSDVSFYNSWVTKIISE 266
            ..|.|||:.       |...:.||....:.|.:|| |..::.|.||..|:.:.:::
  Fly   263 NGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQLAK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 63/243 (26%)
Tryp_SPc 38..263 CDD:304450 64/246 (26%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 64/246 (26%)
Tryp_SPc 73..312 CDD:214473 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.