DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG4815

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:300 Identity:70/300 - (23%)
Similarity:121/300 - (40%) Gaps:87/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKIALVLPKNITTIKIN------HYHEPTYSHLSSYLVSL--------RTRKYIHTPGDNHFCT 58
            |:::.|:| .::.|...|      .:|...|:.:.:.:.||        ..||.:        |:
  Fly     7 LVRLLLIL-NSVRTEAGNREEWTGRFHPRIYNGIKTTVESLGGVGIQLFNGRKLV--------CS 62

  Fly    59 GVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKT--PESEEFVVDIHN--------MII 113
            ..:||.||:||:|||..:.|              .|.|..  .:|.||....:|        :.|
  Fly    63 ATLLTPRHILTAAHCFENLN--------------RSKFHVIGGKSAEFTWHGNNFNKNKLIRVQI 113

  Fly   114 HPYYHRNQH-NDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTI---------------GG 162
            ||.|.:.:. .|:|:.|.|       :.|....:|.:.|     |:::               ||
  Fly   114 HPKYAKMKFIADVAVAKTK-------YPLRSKYIGYAQL-----CRSVLHPRDKLIAAGWGFEGG 166

  Fly   163 IFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKS-TEKQMCTTDFGGPL 226
            ::...|::  :|.||.:..|..|   :|   :|.|....|.|  :||..: ..|.:|..|.||||
  Fly   167 VWDESRKK--TFRSMKVGIVSKR---DC---EKQLDRKMPPN--IICAGAYNNKTLCFGDSGGPL 221

  Fly   227 FCDGQLYGIALGSINCSSPD-PVFFSDVSFYNSWVTKIIS 265
            ....|:.||...:..|.:.: |..:..|.:|..::.:.|:
  Fly   222 LLGRQVCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTIN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 63/266 (24%)
Tryp_SPc 38..263 CDD:304450 62/260 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 60/253 (24%)
Trypsin 49..256 CDD:278516 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.