DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG16710

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:242 Identity:63/242 - (26%)
Similarity:98/242 - (40%) Gaps:58/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CTGVILTNRHVLTSAHCI-----------TDKNGVMMSPKRIVVALCASLFKTPE---SEEFVVD 107
            |.|.::|||:|||:|||:           ..::.::.:|.      |.:.....|   .|...:|
  Fly   141 CAGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPD------CVTHINGREHCAPEHLEID 199

  Fly   108 IHNMIIHPYY---HRNQHNDIAIIKLK---RY--------VKLDGHHLAPVVLGNSSLEVGNDCK 158
            :...|.|.:|   ....:||||:::||   ||        |:||      .:..|.|.  .|...
  Fly   200 VDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLD------YIFSNPSF--SNHKL 256

  Fly   159 TIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKST-EKQMCTTDF 222
            .|.| :|:..:: |..:.:|...|..|..|||...:.||..   :.|..||..:. ....|..|.
  Fly   257 QIAG-WGLSHKQ-GYSNVLLQAYVNGRNADECSLSEPSLGL---DKETHICAGNLGGNDTCKGDS 316

  Fly   223 GGPLFC-----DGQ---LYGI-ALGSINCSSPDPVFFSDVSFYNSWV 260
            ||||..     |.:   |.|| :.|...|.. .|..::..|.:..|:
  Fly   317 GGPLMAIMERGDEEFVYLAGITSYGYSQCGY-GPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 62/240 (26%)
Tryp_SPc 38..263 CDD:304450 63/242 (26%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 62/240 (26%)
Tryp_SPc 106..362 CDD:238113 62/240 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.