DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG31265

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:217 Identity:57/217 - (26%)
Similarity:91/217 - (41%) Gaps:22/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHN--MIIHPY 116
            :|.|.|.||....::|:.||:.:     ..|..:.|....:.:..|.:..:..:||.  |...||
  Fly    60 SHNCGGAILNENWIITAGHCVEN-----FIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPY 119

  Fly   117 YHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVN 181
                .|||||::||...:..: ....|:.|....:::|.:....|  :|.......|...:..:.
  Fly   120 ----MHNDIALVKLTENITFN-ELTQPIALPTRPVQLGEEIVLTG--WGSDVAYGSSMEDLHKLT 177

  Fly   182 VELRPFDECLKV--KKSLMAARPENEDLICVKSTEKQ-MCTTDFGGPLFCDGQLYGIALGSINCS 243
            |.|.|.|||.:.  :.|.|..     ..||..|.|.: .|..|.||||..:|||.|:......|.
  Fly   178 VGLVPLDECYETFNRTSSMGV-----GHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCG 237

  Fly   244 SPDPVFFSDVSFYNSWVTKIIS 265
            ...|...::|.:|..|:...:|
  Fly   238 VGLPDVQANVYYYLDWIRSKLS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 55/210 (26%)
Tryp_SPc 38..263 CDD:304450 56/213 (26%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 55/210 (26%)
Tryp_SPc 39..257 CDD:238113 56/213 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.