DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG17477

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:60/252 - (23%)
Similarity:94/252 - (37%) Gaps:63/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESE 102
            |.|||:|..      .:|.|.|.|:::|.::|:.||:   .|...|  |:.||.....:..|   
  Fly    40 YQVSLQTLL------GSHLCGGAIISDRWIITAGHCV---KGYPTS--RLQVATGTIRYAEP--- 90

  Fly   103 EFVVDIHNMIIHP---YYHRN-----QHNDIAIIKLKRYVKLDGHHLA------PVVLGNSSLE- 152
                   ..:.:|   |.|.|     ..|||.::.|...:..:....|      |...|.|.|. 
  Fly    91 -------GAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVF 148

  Fly   153 VGNDCKTIGGIFGVRRQRFGSFH-------SMLLV--NVELRPFDECLKVKKSLMAARPENEDLI 208
            .|...::..|....:.||....|       ||:..  ::||.|...|...:.::.|         
  Fly   149 TGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGA--------- 204

  Fly   209 CVKSTEKQMCTTDFGGPLFCDGQLYGIALGSINCSSPDPVFFSDVSFYNSWVTKIIS 265
                     |..|.||||...|.|.||....:.|:...|..|.::.:|..|:.:.:|
  Fly   205 ---------CHGDSGGPLVHQGTLVGILNFFVPCAQGVPDIFMNIMYYRDWMRQTMS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/245 (24%)
Tryp_SPc 38..263 CDD:304450 59/248 (24%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 59/248 (24%)
Tryp_SPc 27..246 CDD:214473 58/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.