DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and modSP

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:198 Identity:45/198 - (22%)
Similarity:76/198 - (38%) Gaps:44/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HTPGDNHF-CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFK-----TPESEEFVVD 107
            |...|.|| |.|.:||...|:|:|||:.|:...:.........:.|..::     |||.:.  .|
  Fly   390 HNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKR--RD 452

  Fly   108 IHNMIIHPYYH---RNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSL----EVGNDCKTIGGIFG 165
            :..:.|.|.|.   .|.:.|:|::.|....:| .|.:.|:.:..:|.    .|.:|.:       
  Fly   453 VRLIEIAPGYKGRTENYYQDLALLTLDEPFEL-SHVIRPICVTFASFAEKESVTDDVQ------- 509

  Fly   166 VRRQRFGSF--------HSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQM-CTTD 221
                  |.|        |.:..|....:....|.:..:.:.|      |..|:.:..|.: |..|
  Fly   510 ------GKFAGWNIENKHELQFVPAVSKSNSVCRRNLRDIQA------DKFCIFTQGKSLACQGD 562

  Fly   222 FGG 224
            .||
  Fly   563 SGG 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 45/198 (23%)
Tryp_SPc 38..263 CDD:304450 45/198 (23%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 45/198 (23%)
Tryp_SPc 371..591 CDD:304450 45/198 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.