DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and snk

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:228 Identity:58/228 - (25%)
Similarity:98/228 - (42%) Gaps:38/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMII--HP---- 115
            |.|.:::..:|||:|||.|..:    .|..:|......|.:|..:::   ||..:||  ||    
  Fly   220 CGGALVSELYVLTAAHCATSGS----KPPDMVRLGARQLNETSATQQ---DIKILIIVLHPKYRS 277

  Fly   116 --YYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGN-SSLEVGNDCKTIGGIFGVRRQRFGS-FHS 176
              |||     |||::||.|.||. ...:.|..|.. ..|::    .|:......|.:..|: .::
  Fly   278 SAYYH-----DIALLKLTRRVKF-SEQVRPACLWQLPELQI----PTVVAAGWGRTEFLGAKSNA 332

  Fly   177 MLLVNVELRPFDECLKV-KKSLMAARPENEDLICVKSTE--KQMCTTDFGGPLF-------CDGQ 231
            :..|::::.|...|.:: :|.....|...|...|.....  :..|..|.|||:.       |...
  Fly   333 LRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAF 397

  Fly   232 LYGIALGSINCSSPD-PVFFSDVSFYNSWVTKI 263
            :.||......|::|: |..::.:..|..|:.||
  Fly   398 VVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 55/223 (25%)
Tryp_SPc 38..263 CDD:304450 56/226 (25%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 56/226 (25%)
Tryp_SPc 186..427 CDD:214473 55/223 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.