DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG18223

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:301 Identity:79/301 - (26%)
Similarity:136/301 - (45%) Gaps:53/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLAY--------FLLLKIALVLPKNITTIKINHYHEPTYSH---------------------LS 36
            :||.|        |||. :.|:||       |....:|..||                     |:
  Fly     2 LLLKYGVSRKIFSFLLF-LLLLLP-------ILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLA 58

  Fly    37 SYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVM-MSPKRIVVALCASLFKTPE 100
            .|:||:|:|:.....||||||.|||::..::||||||..||..:: .|...:|||...:..|:.:
  Fly    59 KYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRK 123

  Fly   101 SEEFVVDIHNMIIHPYYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFG 165
            .....:::..:.:...:.....|:||::.|.:.:.||...:..:.|..:..|.|.:...:|  :|
  Fly   124 GLSLNMEVKKIFVPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLG--WG 186

  Fly   166 VRRQRFGSFHSMLL-VNVELRPFDECLK----VKKSLMAARPENEDLICVKSTEKQMCTTDFGGP 225
             |..:.|...|.:| ::|||.|.|.|.|    .|:.:|.|...|..:      ::..|..|.|.|
  Fly   187 -RIFKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTM------DENPCAGDTGSP 244

  Fly   226 LFCDGQLYGIALGSINCSSPD-PVFFSDVSFYNSWVTKIIS 265
            |..:..::|:....:.|.|.. |..:::|..:..|:..|::
  Fly   245 LIFNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 67/258 (26%)
Tryp_SPc 38..263 CDD:304450 64/231 (28%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 64/231 (28%)
Tryp_SPc 60..280 CDD:214473 63/228 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H117632
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.