DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and PRSS57

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_999875.2 Gene:PRSS57 / 400668 HGNCID:31397 Length:283 Species:Homo sapiens


Alignment Length:291 Identity:69/291 - (23%)
Similarity:113/291 - (38%) Gaps:56/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKIALVL------PKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRH 66
            ||.:|..|      |......:|...||.| .|...|:.|:|.       |..|.|.|.:|..|.
Human    12 LLTVATALMLPVKPPAGSWGAQIIGGHEVT-PHSRPYMASVRF-------GGQHHCGGFLLRARW 68

  Fly    67 VLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQH-NDIAIIKL 130
            |:::|||.:.::     .:..:|.|.|.:..|.|..:.|..|..:..||.||...| |||.:::|
Human    69 VVSAAHCFSHRD-----LRTGLVVLGAHVLSTAEPTQQVFGIDALTTHPDYHPMTHANDICLLRL 128

  Fly   131 KRYVKL---------DGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSML--LVNVEL 184
            .....|         .|....|..       .|..|:..|..|      ...|..:.  |:..::
Human   129 NGSAVLGPAVGLLRPPGRRARPPT-------AGTRCRVAGWGF------VSDFEELPPGLMEAKV 180

  Fly   185 RPFDE--CLKVKKSLMAARPENEDLICVKSTE---KQMCTTDFGGPLFCDGQLYG-IALGSINCS 243
            |..|.  |....|..:..     .::|.:|.:   :..|:.|.||||.|..:.:| ::...:.|.
Human   181 RVLDPDVCNSSWKGHLTL-----TMLCTRSGDSHRRGFCSADSGGPLVCRNRAHGLVSFSGLWCG 240

  Fly   244 SP-DPVFFSDVSFYNSWVTKIISEAVDHTRP 273
            .| .|..::.||.:.:|:..::..:.....|
Human   241 DPKTPDVYTQVSAFVAWIWDVVRRSSPQPGP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 60/249 (24%)
Tryp_SPc 38..263 CDD:304450 58/243 (24%)
PRSS57NP_999875.2 Tryp_SPc 34..258 CDD:238113 62/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.