DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG7542

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:236 Identity:53/236 - (22%)
Similarity:93/236 - (39%) Gaps:39/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEE----FVVDIHNMIIHPY 116
            :|.|.::::..::|:|||:.....|.:....|.:.        .||||    .:|:...:|:|..
  Fly    54 WCGGTLISHYWIITAAHCMDGAESVTVYLGAINIG--------DESEEGQERIMVEKSGIIVHSN 110

  Fly   117 YHRNQ-HNDIAIIKLKRYVKLDGHHLA---PVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSM 177
            |..:. .|||::|:|..:|.......|   |..| |.........:.....:|.......|...:
  Fly   111 YMASTVVNDISLIRLPAFVGFTDRIRAASLPRRL-NGQFPTYESIRAFASGWGRESDASDSVSPV 174

  Fly   178 L-LVNVELRPFDECLKVKKSLMAARPENEDLICVKSTE-KQMCTTDFGGPL---------FCDGQ 231
            | .|.:.:.|...|     .:..:...:|.:||:.:|. |..|..|.||||         .....
  Fly   175 LRYVEMPIMPHSLC-----RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGST 234

  Fly   232 LYGIALGSINCSSPDPVFFSDVSFYNSWVTKIISEAVDHTR 272
            .:|.::|   |....|..|:.:|.|..|   |::..:.|.:
  Fly   235 SFGTSMG---CQVGFPAVFTRISSYLDW---ILNHIIAHNK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 50/222 (23%)
Tryp_SPc 38..263 CDD:304450 51/225 (23%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 52/228 (23%)
Tryp_SPc 27..260 CDD:214473 51/225 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.