DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG33460

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:289 Identity:59/289 - (20%)
Similarity:113/289 - (39%) Gaps:65/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAYFLLLKIALVLPKNITTIKINHYHEPTYSHLSSYLVSLRT-RKYIHTPGDNHFCTGVILTNRH 66
            |...||....||:..:  ::..|:.:|........:..||.. ...:||.| :.||.|.::|:..
  Fly     5 LTISLLASYMLVIYSD--SVSANYLYEQCGLMREEFSTSLGPWTALLHTDG-SIFCAGTLITDVF 66

  Fly    67 VLTSAHCITDKNGVMMSPKRIVVALCASLFKTPES--EEFVVDIHNMIIHPYYHRNQ-HNDIAII 128
            :||:|.||        .|..:.|.| ....:.|..  |:.:|  |..:::..::... .|:|.::
  Fly    67 ILTAASCI--------RPNAVKVRL-GEFGRYPNELPEDHLV--HYFLMYRLFNNESLANNIGLL 120

  Fly   129 KLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKV 193
            ||.:.|::..:.:...::.|...:..:..:.||..:        ...|.:.:..||||.      
  Fly   121 KLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW--------MEDSNVSLTKELRPI------ 171

  Fly   194 KKSLMAARPE---NEDLICVKSTEKQMCTTDFGGPLFCDGQL------------------YGIA- 236
               ::.::|:   |.||.      .|.|....|....|||..                  :||| 
  Fly   172 ---VIQSKPKMCTNLDLY------TQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIAT 227

  Fly   237 LGSINCSSPDPVFFSDVSFYNSWVTKIIS 265
            :..::|.....  ::||..:..|:..::|
  Fly   228 VNDMDCEESQG--YTDVLKFYWWIQDVVS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 51/256 (20%)
Tryp_SPc 38..263 CDD:304450 51/250 (20%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 49/244 (20%)
Tryp_SPc 44..249 CDD:214473 48/241 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.