DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG33465

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:286 Identity:69/286 - (24%)
Similarity:112/286 - (39%) Gaps:64/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKIALVL--------------PKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCT 58
            |..|.|||              ||....|..||....|...::|.   .:..::|        |.
  Fly     7 LALIGLVLCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASI---YKNNQFI--------CD 60

  Fly    59 GVILTNRHVLTSAHCITDKNGV-----MMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYH 118
            |.::....|||:|.||:..:.:     |.:..|     .||.|...|.....|.:.:....|   
  Fly    61 GTLVHKLFVLTAASCISKDSQLYVLFGMYNQYR-----DASQFFNNEQYGVAVALQHSNFRP--- 117

  Fly   119 RNQHNDIAIIKLKRYVKLDGH-HLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNV 182
            .|..|||.:::|  |.::..: |:.|:.:....:......:...| ||.::|...: .|.:...|
  Fly   118 NNGVNDIGLLRL--YGEVTHYAHIRPICIILDHVVKSAPFERFEG-FGWQQQGTEA-SSQVRQTV 178

  Fly   183 EL---RPFDECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFCDGQLYG---------- 234
            .|   :|| ||.:..:.|    |.||...|..:.::..|.::.|.||..| ..||          
  Fly   179 YLSQKKPF-ECHRNGQLL----PINEGQFCAGNRDRSFCRSNSGSPLTAD-FTYGVKNITVQVGL 237

  Fly   235 IALGSINCSSPDPVFFSDVSFYNSWV 260
            ::.||..| ||..| ::||..:..|:
  Fly   238 VSYGSELC-SPTSV-YTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/249 (23%)
Tryp_SPc 38..263 CDD:304450 57/242 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 58/247 (23%)
Tryp_SPc 46..261 CDD:214473 57/245 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.