DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG10472

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:242 Identity:61/242 - (25%)
Similarity:99/242 - (40%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDK--NGVMMSPKRIVVALCASLFKTPE 100
            |.|.|    .::..|...:|.|.|:::|.::|:||| ||.  .||.:        ...:..:|..
  Fly    60 YQVGL----LLYITGGAAWCGGTIISDRWIITAAHC-TDSLTTGVDV--------YLGAHDRTNA 111

  Fly   101 SEE----FVVDIHNMIIH-PYYHRNQHNDIAIIKLKRYVKLDGHHLAPV---VLGNSSLEVGNDC 157
            .||    ..|:..|:|:| .:......|||::|||...::.: .::.|.   |..:|....|.:.
  Fly   112 KEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFN-KYIQPAKLPVKSDSYSTYGGEN 175

  Fly   158 KTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEK-QMCTTD 221
            ....|...:.....|:...:....|.:.....|......|:||     ..||:|:|.. ..|..|
  Fly   176 AIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAA-----SNICIKTTGGISTCNGD 235

  Fly   222 FGGPLFCD--------GQLYGIALGSINCSSPDPVFFSDVSFYNSWV 260
            .||||..|        ...:|||||   |....|..|:.:::|..|:
  Fly   236 SGGPLVLDDGSNTLIGATSFGIALG---CEVGWPGVFTRITYYLDWI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 60/240 (25%)
Tryp_SPc 38..263 CDD:304450 61/242 (25%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 60/240 (25%)
Tryp_SPc 47..282 CDD:238113 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.