DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:283 Identity:68/283 - (24%)
Similarity:99/283 - (34%) Gaps:102/283 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVV 89
            |.|  |.|.....|:|:||   :.:..|...:|.|.|:.:..|||:|||....:.|.:|      
  Fly    39 NGY--PAYEGKVPYIVALR---FDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTIS------ 92

  Fly    90 ALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIAIIK--------------LKRY------- 133
              ..::::  :..:|.        | |...|.|||||:|:              |.||       
  Fly    93 --YGAVWR--QQPQFT--------H-YDTGNLHNDIALIRTPHVDFWSLVNKVELPRYDDRYNNF 144

  Fly   134 ----VKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLK-- 192
                ..|.|       .|:||                  ...|....:..|::::.....||.  
  Fly   145 YGWWALLSG-------WGSSS------------------DSSGMTDYLNCVDIQISDNSVCLDYY 184

  Fly   193 -----VKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFC-DG--QLYGIALGS-INCSSPDPV 248
                 ....|..|.|||          |..|:.|.||||.. ||  |:..::.|| ..|.|..|.
  Fly   185 GSHYITSNHLCYATPEN----------KGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPK 239

  Fly   249 FFSDVSFYNSWVTKIISEAVDHT 271
            ..:.|:.|..|:.       |||
  Fly   240 GLTRVTGYLDWIR-------DHT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 62/266 (23%)
Tryp_SPc 38..263 CDD:304450 61/260 (23%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 64/270 (24%)
Tryp_SPc 37..254 CDD:238113 65/280 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.